xKg-ddlZddlZddlZddlmZddlmZddlmZddl m Z ddl m Z ddl mZGddZed gd Zd ZGd d ZedddgZGddeZy)N) namedtuple)Sequence)contextmanager)cached_property)configc(eZdZdZdgZdZdZdZy)RecordLLVMPassTimingsz9A helper context manager to track LLVM pass timings. _datac0tjd|S)z)Enables the pass timing in LLVM. T)llvmset_time_passesselfs `/home/alanp/www/video.onchill/myenv/lib/python3.12/site-packages/numba/misc/llvm_pass_timings.py __enter__zRecordLLVMPassTimings.__enter__s T" c`tj|_tjdy)z2Reset timings and save report internally. FN)r report_and_reset_timingsr r )rexc_valexc_typeexc_tbs r__exit__zRecordLLVMPassTimings.__exit__s%224  U#rc,t|jS)ztRetrieve timing data for processing. Returns ------- timings: ProcessedPassTimings )ProcessedPassTimingsr rs rgetzRecordLLVMPassTimings.get!s$DJJ//rN)__name__ __module__ __qualname____doc__ __slots__rrrrrr r s I 0rr PassTimingRecord) user_time user_percent system_timesystem_percentuser_system_timeuser_system_percent wall_time wall_percent pass_name instructionc|djdk(sJfd}dDcgc] }|| c}td|}fd}tt||Scc}w)zAdjust timing records because of truncated information. Details: The percent information can be used to improve the timing information. Returns ------- res: List[PassTimingRecord] Totalc\|d|dtjfd}|S)N_time_percentc8}||zdz}||<|S)z'Compute percent x total_time = adjustedg{Gz?r!)dtotaladjusted percent_attr time_attr time_getter total_recs radjustz6_adjust_timings..make_adjuster..adjustNs. *Eq.5H#AiLHr)operator attrgetter)attrr;r7r8r9r:s @@@r make_adjusterz&_adjust_timings..make_adjusterIs6fEN x( )))4   r)usersystem user_systemwallc"|jSN)_asdictxs rz!_adjust_timings..]s !))+rc8D] }||} tdi|S)Nr!)r")r4fnadj_fnss rchainedz _adjust_timings..chained_s&B1A $!$$r)r+maplist)recordsr?rHdictsrMrLr:s @@r_adjust_timingsrR<sv I   ' )) )  #L"KQ a"KG %w /E% GU# $$sAcReZdZdZdZdZdZdZdZdZ d dZ e d Z d Z y ) rzA class for processing raw timing report from LLVM. The processing is done lazily so we don't waste time processing unused timing information. c||_yrE _raw_data)rraw_datas r__init__zProcessedPassTimings.__init__ps !rc,t|jSrE)boolrVrs r__bool__zProcessedPassTimings.__bool__ssDNN##rc|jS)zWReturns the raw string data. Returns ------- res: str rUrs r get_raw_dataz!ProcessedPassTimings.get_raw_datavs~~rc<|jdjS)zhCompute the total time spend in all passes. Returns ------- res: float r.) list_recordsr)rs rget_total_timez#ProcessedPassTimings.get_total_times  "2&000rc|jS)z{Get the processed data for the timing report. Returns ------- res: List[PassTimingRecord] ) _processedrs rr_z!ProcessedPassTimings.list_recordssrc|j}tjd}tj||dd|S)aReturns the top(n) most time-consuming (by wall-time) passes. Parameters ---------- n: int This limits the maximum number of items to show. This function will show the ``n`` most time-consuming passes. Returns ------- res: List[PassTimingRecord] Returns the top(n) most time-consuming passes in descending order. r)Nr.)r_r<r=heapqnlargest)rnrPkeys rlist_topzProcessedPassTimings.list_tops;##%!!+.~~a"s33rc gd|zfd}|d|jdd|d|j|D]3}|d|jdd|jd d |j5d j S) aReturn a string summarizing the timing information. Parameters ---------- topn: int; optional This limits the maximum number of items to show. This function will show the ``topn`` most time-consuming passes. indent: int; optional Set the indentation level. Defaults to 0 for no indentation. Returns ------- res: str  c0j|yrE)append)argbufprefixs rapz(ProcessedPassTimings.summary..aps JJ&#' (rzTotal .4fsz Top timings:z zs (5z%)  )r`rhr)r*r+join)rtopnindentrpprnros @@rsummaryzProcessedPassTimings.summarysv ) VD'')#.a 01 >t$A AKK$Cq'9Q[[MJ K%yy~rc"|jS)ztA cached property for lazily processing the data and returning it. See ``_process()`` for details. )_processrs rrbzProcessedPassTimings._processeds }}rcTd}t||j}t|S)zParses the raw string data from LLVM timing report and attempts to improve the data by recomputing the times (See `_adjust_timings()``). c 3K|j}d}d|d}t|}dddddd d }|D]R}tj||}|stjd |}|D cgc]} || j } } n d d k(sJg} d } d} | dd D]A} | dk(r| | z } | j | d| j | d| d| d| dz } Ci}tjD]} | | vs| d k7sd|| <| dz } |D]}tj| |}|t|j}t| |D cic]\} }| | t|nd}} }|j||d }tdd |i|}||jdk(sndj|}|rt!d|ycc} wcc}} ww)zwA generator that parses the raw_data line-by-line to extract timing information for each pass. z [a-zA-Z+ ]+z(?:\s*-+z-+)+r@rArBrCr,r+)z User Timez System Timez User+Systemz Wall TimeInstrNamez[a-zA-Z][a-zA-Z+ ]+r.z\s*((?:[0-9]+\.)?[0-9]+)Nr1r2z\s+(?:z\s*\(z%\)|-+)gz\s*(.*)r/rtz'unexpected text after parser finished: r!) splitlinesiterrematchfindallstriprlr"_fieldsrOgroupszipfloatupdater+ru ValueError)rWlines colheadermulticolheaders line_iter header_maplnm raw_headerskheadersattrsrfpatmissingvdatar+rec remainings rparsez,ProcessedPassTimings._process..parsesC'')E&I!))D9OU I$',#&# J HH_b1"$**-CR"HK>IJkz!'')4kGJ  2;+- --E+ACSb\ %1HCLLA3e-LLA3h0fQCuQCw77C "G%--E>a;&6!$GAJ. : CHHS"%=#AHHJ/H(+E8(<>(<11=uQxcA(<>KK( ( I*"+/3CI}}/  ),I >ykJQK6>s=A G G'G A7G9G?)G)(GG+9G%0G)rOrVrR)rrrPs rr{zProcessedPassTimings._processs) C LuT^^,-w''rN)r)rrrrrXr[r]r`r_rhryrrbr{r!rrrrisD "$14$6M(rr NamedTimingsnametimingscbeZdZdZdZedZdZdZdZ e dZ d dZ d Z d Zd Zy )PassTimingsCollectionzA collection of pass timings. This class implements the ``Sequence`` protocol for accessing the individual timing records. c ||_g|_yrE)_name_records)rrs rrXzPassTimingsCollection.__init__ s  rc#Ktjr=t5}ddddj}|r|j ||yydy#1swY4xYww)aRecord new timings and append to this collection. Note: this is mainly for internal use inside the compiler pipeline. See also ``RecordLLVMPassTimings`` Parameters ---------- name: str Name for the records. N)rLLVM_PASS_TIMINGSr r_append)rrrrs rrecordzPassTimingsCollection.record$sO  # #&(G)++-C T3' )(sA!A3A!AA!cN|jjt||y)zAppend timing records Parameters ---------- name: str Name for the records. timings: ProcessedPassTimings the timing records. N)rrlr)rrrs rrzPassTimingsCollection._append=s \$89rcT|jrtd|jDSy)zComputes the sum of the total time across all contained timings. Returns ------- res: float or None Returns the total number of seconds or None if no timings were recorded c3PK|]}|jj ywrErr`).0rs r z7PassTimingsCollection.get_total_time..SsI=aqyy//1=s$&N)rsumrs rr`z$PassTimingsCollection.get_total_timeIs# ==I4==II Irc4t|jddS)zReturns the timings in descending order of total time duration. Returns ------- res: List[ProcessedPassTimings] c6|jjSrErrGs rrIz:PassTimingsCollection.list_longest_first.._sAII$<$<$>rT)rgreverse)sortedrrs rlist_longest_firstz(PassTimingsCollection.list_longest_firstWsdmm>"$ $rc|j S)z rrs ris_emptyzPassTimingsCollection.is_emptybs==  rc|jryg}|j}|d|j|j}|d|dt |j D]m\}}|d|d|j |jj|z dz}|d|d d ||jj|d od j|S)aReturn a string representing the summary of the timings. Parameters ---------- topn: int; optional, default=5. This limits the maximum number of items to show. This function will show the ``topn`` most time-consuming passes. Returns ------- res: str See also ``ProcessedPassTimings.summary()`` zNo pass timings were recordedzPrinting pass timings for z Total time: rqz== #rjdz Percent: z.1f%)rvrwrt) rrlrr` enumeraterrrryru)rrvrnrp overall_timeirpercents rryzPassTimingsCollection.summaryhs ==2CB +DJJ<8 9..0L l3/0 1!$--01T!AaffX&'))224|CcIZ}A./199$$$q$9: 1 99S> !rc |j|S)zGet the i-th timing record. Returns ------- res: (name, timings) A named tuple with two fields: - name: str - timings: ProcessedPassTimings r)rrs r __getitem__z!PassTimingsCollection.__getitem__s}}Qrc,t|jS)z#Length of this collection. )lenrrs r__len__zPassTimingsCollection.__len__s4==!!rc"|jSrE)ryrs r__str__zPassTimingsCollection.__str__s||~rN)r)rrrrrXrrrr`rpropertyrryrrrr!rrrrsW 0 :  $!! "<  " rr)rr<rd collectionsrcollections.abcr contextlibr functoolsr numba.corerllvmlite.bindingbindingr r r"rRrrrr!rrrss  "$%%00: "*%Zj(j(Z.69*=> @H@r